AibGenesis™ Mouse Anti-FAM133A Antibody (CBMOAB-42251FYA)


Cat: CBMOAB-42251FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42251FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO42251FYA 100 µg
MO-AB-03687W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03687W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO42251FYA
SpecificityThis antibody binds to Rhesus FAM133A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM133A Antibody is a mouse antibody against FAM133A. It can be used for FAM133A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein FAM133A; FAM133A
UniProt IDH9FFF5
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: KKKKKSCRSSSSSSSSDSSSSSSDSEDEEKKQGKRRKKKKNRSYKSSQSSTYESESESKESVKKKKKSKDETEKEKDIRSLSKKRKKSYPGDKPLSSESSSESDYEEDVQAKKKRRCEEREQAKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry