AibGenesis™ Mouse Anti-FAM163B Antibody (CBMOAB-42299FYA)


Cat: CBMOAB-42299FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42299FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO42299FYA 100 µg
CBMOAB-75817FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO75817FYA 100 µg
MO-AB-25733H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25733C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO42299FYA
SpecificityThis antibody binds to Rhesus FAM163B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM163B Antibody is a mouse antibody against FAM163B. It can be used for FAM163B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative: protein FAM163B-like; FAM163B
UniProt IDH9EZL7
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKDESEEDEEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPAFFLQEPPEEEEDVLNGGERVLYKSVSQEDVELPAGGFGGLQALNPNRLSAM.
For Research Use Only | Not For Clinical Use.
Online Inquiry