AibGenesis™ Mouse Anti-FAM167B Antibody (CBMOAB-42305FYA)


Cat: CBMOAB-42305FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42305FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO42305FYA 100 µg
MO-AB-03689W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03689W 100 µg
MO-AB-24085W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24085W 100 µg
MO-AB-25735H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25735C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO42305FYA
SpecificityThis antibody binds to Rhesus FAM167B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM167B Antibody is a mouse antibody against FAM167B. It can be used for FAM167B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM167B
UniProt IDH9H4G7
Protein RefseqThe length of the protein is 74 amino acids long.
The sequence is show below: MQAQDRQLAGQLLRLRAQLHRLKMDQACHLHQELLDEAELELELEPGAGLALAPLLRHLGLTRMNISARRFTLC.
For Research Use Only | Not For Clinical Use.
Online Inquiry