AibGenesis™ Mouse Anti-FAM185A Antibody (CBMOAB-42351FYA)


Cat: CBMOAB-42351FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42351FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO42351FYA 100 µg
CBMOAB-59903FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO59903FYC 100 µg
MO-AB-03465H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03465C 100 µg
MO-AB-25746H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25746C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO42351FYA
SpecificityThis antibody binds to Rhesus FAM185A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFAM185A (Family With Sequence Similarity 185 Member A) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus FAM185A Antibody is a mouse antibody against FAM185A. It can be used for FAM185A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM185A
UniProt IDF7HNQ1
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: MLAPCSGWELGCLRLCLRQVRLWAGTGRWASWACQARPYGSGRGKPWPGSEAEVPPPGPARRTLKEWTLQVSPFGRLRARLPCHLAVRPLDPLTYPDGDRVLVAVCGVEGSARGLDGLQVKYDEALEEMAILSDTIDPQAFVEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry