AibGenesis™ Mouse Anti-FAM195A Antibody (CBMOAB-42374FYA)


Cat: CBMOAB-42374FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-42374FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) WB, ELISA MO42374FYA 100 µg
MO-AB-26780W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26780W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes)
CloneMO42374FYA
SpecificityThis antibody binds to Rhesus FAM195A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FAM195A Antibody is a mouse antibody against FAM195A. It can be used for FAM195A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFAM195A
UniProt IDF7DAP6
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MAGGPPPRPHPSRGPRRPTHWPTRRMSALCPKPGSRCSSSWMVAQPVRAGQGLCSTWRGPPIPGCRVSPPTLSPQEKPPSPSDPDPGPARFPPQGMREGTLVQKLLPSACCTQSPGEWLVVSSRGEMLASLGGSITAQRSLPTDFVPIDLDEWWAQQFLARITSCS.
For Research Use Only | Not For Clinical Use.
Online Inquiry