Mouse Anti-Rhesus FOXC1 Antibody (CBMOAB-43078FYA)


Cat: CBMOAB-43078FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO43078FYA
SpecificityThis antibody binds to Rhesus FOXC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly.
Product OverviewMouse Anti-Rhesus FOXC1 Antibody is a mouse antibody against FOXC1. It can be used for FOXC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFOXC1
UniProt IDF6W0X8
Protein RefseqThe length of the protein is 386 amino acids long.
The sequence is show below: MQARYSVSSPNSLGVVPYLGGEQSYYTAMPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDAVKDKEEKDRLHLKEQADGNAPGPQPPPVRIQDIKTENGTCPSPPQPLSPAAALGSGSAATVPKIESPDSSSSSLSSGSSPPGSLPSARPLSLDGADHHSQGFSVDNIMTSLRGSPQSAAAELGSGLLASAAASSRAGIAPPLALGAYSPGQSSLYSSPCSQSSSAGSTYHXVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF.
See other products for " FOXC1 "
MO-AB-55607WMouse Anti-Marmoset FOXC1 Antibody (MO-AB-55607W)
MO-MMB-0580Anti-FOXC1 Antibody (Cat MO-MMB-0580), Goat IgG
MO-AB-22085WMouse Anti-Chimpanzee FOXC1 Antibody (MO-AB-22085W)
MO-DKB-03276WGoat Anti-FOXC1 (C-terminal) Antibody (Cat MO-DKB-03276W)
For Research Use Only | Not For Clinical Use.
Online Inquiry