AibGenesis™ Mouse Anti-FXYD3 Antibody (CBMOAB-43241FYA)
Cat: CBMOAB-43241FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-43241FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO43241FYA | 100 µg | ||
| CBMOAB-60044FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60044FYC | 100 µg | ||
| MO-AB-11453Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11453Y | 100 µg | ||
| MO-AB-12780R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12780R | 100 µg | ||
| MO-AB-25911H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25911C | 100 µg | ||
| MO-AB-25955R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25955R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO43241FYA |
| Specificity | This antibody binds to Rhesus FXYD3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus FXYD3 Antibody is a mouse antibody against FXYD3. It can be used for FXYD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | FXYD3 |
| UniProt ID | F7H5I7 |
| Protein Refseq | The length of the protein is 87 amino acids long. The sequence is show below: MQKVTLGLLVFLVGLPVLDANDPEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSGKCKCKFGQKPSHHPGETPPLITPGKDGA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry