AibGenesis™ Mouse Anti-G0S2 Antibody (CBMOAB-43270FYA)


Cat: CBMOAB-43270FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43270FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO43270FYA 100 µg
CBMOAB-77352FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77352FYA 100 µg
MO-AB-12795R Monoclonal Cattle (Bos taurus) WB, ELISA MO12795R 100 µg
MO-AB-15321Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15321Y 100 µg
MO-AB-16954W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16954W 100 µg
MO-AB-25918H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25918C 100 µg
MO-AB-25970R Monoclonal Pig (Sus scrofa) WB, ELISA MO25970R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO43270FYA
SpecificityThis antibody binds to Rhesus G0S2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPromotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus G0S2 Antibody is a mouse antibody against G0S2. It can be used for G0S2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesG0/G1 switch regulatory protein 2; G0S2
UniProt IDH9EX31
Protein RefseqThe length of the protein is 103 amino acids long.
The sequence is show below: METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETGCSPFTAASRLRDQEAAVAELQATLERQALQKQALQEKGKQQDTVLGGRALSNRPHAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry