AibGenesis™ Mouse Anti-GBAS Antibody (CBMOAB-43418FYA)


Cat: CBMOAB-43418FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43418FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43418FYA 100 µg
CBMOAB-60065FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60065FYC 100 µg
CBMOAB-77626FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77626FYA 100 µg
MO-AB-11036W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11036W 100 µg
MO-AB-55889W Monoclonal Marmoset WB, ELISA MO55889W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO43418FYA
SpecificityThis antibody binds to Rhesus GBAS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus GBAS Antibody is a mouse antibody against GBAS. It can be used for GBAS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGBAS
UniProt IDF6RU91
Protein RefseqThe length of the protein is 288 amino acids long.
The sequence is show below: MAARVLRARGAAWAGGLIRRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLDREDIRNAAHKHGWRNCAVTLILFSVPLIQEMESRIMIPLKTSPLQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry