AibGenesis™ Mouse Anti-GPR88 Antibody (CBMOAB-44038FYA)


Cat: CBMOAB-44038FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44038FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44038FYA 100 µg
CBMOAB-78535FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78535FYA 100 µg
MO-AB-56305W Monoclonal Marmoset WB, ELISA MO56305W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO44038FYA
SpecificityThis antibody binds to Rhesus GPR88.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a G protein-coupled receptor found almost exclusively in the striatum, a brain structure that controls motor function and cognition. Defects in this gene have been associated with chorea, speech delay, and learning difficulties, as well as some neuropsychiatric disorders. (From NCBI)
Product OverviewMouse Anti-Rhesus GPR88 Antibody is a mouse antibody against GPR88. It can be used for GPR88 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative G-protein coupled receptor 88; GPR88
UniProt IDH9F035
Protein RefseqThe length of the protein is 243 amino acids long.
The sequence is show below: MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPAGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGATPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry