Mouse Anti-Rhesus GSTO2 Antibody (CBMOAB-60167FYC)


Cat: CBMOAB-60167FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO60167FYC
SpecificityThis antibody binds to Rhesus GSTO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGSTO2 (Glutathione S-Transferase Omega 2) is a Protein Coding gene. Diseases associated with GSTO2 include Barrett's Adenocarcinoma and Skin Carcinoma. Among its related pathways are Drug metabolism - cytochrome P450 and Metabolism of water-soluble vitamins and cofactors. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity and protein disulfide oxidoreductase activity. An important paralog of this gene is GSTO1.
Product OverviewMouse Anti-Rhesus GSTO2 Antibody is a mouse antibody against GSTO2. It can be used for GSTO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase omega-2 isoform 1; GSTO2
UniProt IDH9F4P6
Protein RefseqThe length of the protein is 212 amino acids long.
The sequence is show below: CPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPHDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTDLKAALRQEFCNLEEILEYQNTTFFGGTCTSMIDYLLWPWFERLDVYGIADCVSHTPALRLWISAMKWDPTVCALLTDKSIFQGFLNLYFQNNPNAFDFGLC.
See other products for " GSTO2 "
CBMOAB-44213FYAMouse Anti-Rhesus GSTO2 Antibody (CBMOAB-44213FYA)
MO-AB-04098HMouse Anti-Frog gsto2 Antibody (MO-AB-04098H)
CBMOAB-18307FYAMouse Anti-D. melanogaster Gsto2 Antibody (CBMOAB-18307FYA)
CBMOAB-04802HCBMouse Anti-C. elegans GSTO2 Antibody (CBMOAB-04802HCB)
CBMOAB-78844FYAMouse Anti-Zebrafish gsto2 Antibody (CBMOAB-78844FYA)
MO-AB-23494WMouse Anti-Chimpanzee GSTO2 Antibody (MO-AB-23494W)
MO-AB-26163HMouse Anti-Rat Gsto2 Antibody (MO-AB-26163H)
For Research Use Only | Not For Clinical Use.
Online Inquiry