AibGenesis™ Mouse Anti-GTPBP8 Antibody (CBMOAB-44267FYA)


Cat: CBMOAB-44267FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44267FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO44267FYA 100 µg
CBMOAB-60176FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60176FYC 100 µg
CBMOAB-78934FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78934FYA 100 µg
MO-AB-10882W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10882W 100 µg
MO-AB-13440R Monoclonal Cattle (Bos taurus) WB, ELISA MO13440R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO44267FYA
SpecificityThis antibody binds to Rhesus GTPBP8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GTPBP8 Antibody is a mouse antibody against GTPBP8. It can be used for GTPBP8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTPBP8
UniProt IDF6TXH9
Protein RefseqThe length of the protein is 304 amino acids long.
The sequence is show below: MAAPGLRLGAERLFAMPGVLELLSRSNSTSQAFAEVLRLPKQQLRKLLYPLQEVERFLAPDRRQDLHLRIFDPSPEDIARADNVFTATKGNRIDYVSSAVRIDHAPDLPRPEVRGDTVHLRAGVTALCPGCRARGRFCCRSNVGKSSLIKYFHWPLRSKSESPKNQYVEKMNFFKVGKHFTVVDMPGYGYRAPEDFVDMVETYLKERRNLKRTFLLVDSVVGIQKTDNIAIEMCEEFALPYVIVLTKIDKSSKGHLLKQVLQIQKFVNTKTQGCFPQLFPVSSVTFSGIHLLRSFIASVTGNLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry