AibGenesis™ Mouse Anti-HES7 Antibody (CBMOAB-44496FYA)


Cat: CBMOAB-44496FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44496FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO44496FYA 100 µg
MO-AB-26279H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26279C 100 µg
MO-AB-56694W Monoclonal Marmoset WB, ELISA MO56694W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO44496FYA
SpecificityThis antibody binds to Rhesus HES7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the hairy and enhancer of split family of bHLH transcription factors. The mouse ortholog of this gene is regulated by Notch signaling. The protein functions as a transcriptional repressor, and is implicated in correct patterning of the axial skeleton. A mutation in this gene has been shown to result in spondylocostal dysostosis. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus HES7 Antibody is a mouse antibody against HES7. It can be used for HES7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHES7
UniProt IDF7GUV2
Protein RefseqThe length of the protein is 225 amino acids long.
The sequence is show below: MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRERSRVESPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAARAQLFSALHGYLRPKPPRPKPVEPRPPAPRPSLDPAAPALGPALHQRPPVHQGPPSPRCAWSPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPPPPPPAFWRPWP.
For Research Use Only | Not For Clinical Use.
Online Inquiry