AibGenesis™ Mouse Anti-HMGN3 Antibody (CBMOAB-44662FYA)
Cat: CBMOAB-44662FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44662FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO44662FYA | 100 µg | ||
| CBMOAB-79617FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79617FYA | 100 µg | ||
| MO-AB-04288H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04288C | 100 µg | ||
| MO-AB-13715R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13715R | 100 µg | ||
| MO-AB-21580W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21580W | 100 µg | ||
| MO-AB-26324H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26324C | 100 µg | ||
| MO-AB-56833W | Monoclonal | Marmoset | WB, ELISA | MO56833W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO44662FYA |
| Specificity | This antibody binds to Rhesus HMGN3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancing transcription from chromatin templates. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is a related pseudogene on chromosome 1. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus HMGN3 Antibody is a mouse antibody against HMGN3. It can be used for HMGN3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | High mobility group nucleosome-binding domain-containing protein 3 isoform HMGN3b; HMGN3 |
| UniProt ID | H9ZFF4 |
| Protein Refseq | The length of the protein is 77 amino acids long. The sequence is show below: MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGTEN. |
For Research Use Only | Not For Clinical Use.
Online Inquiry