AibGenesis™ Mouse Anti-IFI27 Antibody (CBMOAB-60290FYC)


Cat: CBMOAB-60290FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-60290FYC Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO60290FYC 100 µg
MO-AB-15664W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15664W 100 µg
MO-AB-26426H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26426C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO60290FYC
SpecificityThis antibody binds to Rhesus IFI27.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IFI27 Antibody is a mouse antibody against IFI27. It can be used for IFI27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesInterferon alpha-inducible protein 27, mitochondrial isoform 1; IFI27
UniProt IDI0FRE8
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MVASAFTSSAVTGVAKVARVASGCAVVLPLARIATVVIGGVVAVEAVPMVLGVMGFPATGITSSSIAAKMMSAAAIANGGGVAPGSLVATLQSLGATGLSGLTRFILGSTGSAIAAGIARFY.
For Research Use Only | Not For Clinical Use.
Online Inquiry