AibGenesis™ Mouse Anti-IFITM5 Antibody (CBMOAB-45074FYA)


Cat: CBMOAB-45074FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45074FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Mallard (Anas platyrhynchos), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45074FYA 100 µg
CBMOAB-80314FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80314FYA 100 µg
MO-AB-13969R Monoclonal Cattle (Bos taurus) WB, ELISA MO13969R 100 µg
MO-AB-23295H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23295C 100 µg
MO-AB-26436H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26436C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Mallard (Anas platyrhynchos), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45074FYA
SpecificityThis antibody binds to Rhesus IFITM5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V (PMID: 22863190, 22863195). (From NCBI)
Product OverviewMouse Anti-Rhesus IFITM5 Antibody is a mouse antibody against IFITM5. It can be used for IFITM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIFITM5
UniProt IDF6PZ75
Protein RefseqThe length of the protein is 132 amino acids long.
The sequence is show below: MDTAYPREDPRAPTPSKARAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDGDYD.
For Research Use Only | Not For Clinical Use.
Online Inquiry