AibGenesis™ Mouse Anti-IQCF3 Antibody (MO-AB-03833W)


Cat: MO-AB-03833W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03833W Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO03833W 100 µg
MO-AB-26553H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26553C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO03833W
SpecificityThis antibody binds to Rhesus IQCF3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus IQCF3 Antibody is a mouse antibody against IQCF3. It can be used for IQCF3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIQ Motif Containing F3
UniProt IDG7ML48
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: MGSKCCKGGPDEDAIERQRKRKLLVAQLHHRKRVKAAGKIQAWWRGVLVRRTLLVAALRAWMIQCWWRTLVQRRIHQRQQALLRVYVIQEQAVVKLQSCIRMWQCRQCYRQMCNSLRLFQVPESSLAFQTDSFLQVQYAIPSKQPEFHIEILSI.
For Research Use Only | Not For Clinical Use.
Online Inquiry