AibGenesis™ Mouse Anti-IQCK Antibody (CBMOAB-45529FYA)


Cat: CBMOAB-45529FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45529FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO45529FYA 100 µg
CBMOAB-81042FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81042FYA 100 µg
MO-AB-10923W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10923W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO45529FYA
SpecificityThis antibody binds to Rhesus IQCK.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the IQ motif-containing family of proteins. The IQ motif serves as a binding site for different EF-hand proteins such as calmodulin. This gene was identified as a potential candidate gene for obsessive-compulsive disorder in a genome-wide association study. Alternative splicing of this gene results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus IQCK Antibody is a mouse antibody against IQCK. It can be used for IQCK detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesIQCK
UniProt IDF7HMZ8
Protein RefseqThe length of the protein is 287 amino acids long.
The sequence is show below: MAAPRQVPSHTVPRKPSCSTDSSFTRTPVPTVSLGSRELPVSPWQVAEPSSKNLWEQICDEYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISHTPCPQDKSETVNPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEEWLKQHPRPPIPLSLLLTEEEAALYIQSFWRAYLVRCDPEIQELRQWQKKLREAKHIHQRVKIFWAKQEQKVKCKMEDDVVPAGKMKIPSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry