AibGenesis™ Mouse Anti-ISCA2 Antibody (CBMOAB-45588FYA)


Cat: CBMOAB-45588FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45588FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO45588FYA 100 µg
MO-AB-10517W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10517W 100 µg
MO-AB-14292R Monoclonal Cattle (Bos taurus) WB, ELISA MO14292R 100 µg
MO-AB-26564H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26564C 100 µg
MO-AB-57380W Monoclonal Marmoset WB, ELISA MO57380W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO45588FYA
SpecificityThis antibody binds to Rhesus ISCA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ISCA2 Antibody is a mouse antibody against ISCA2. It can be used for ISCA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesISCA2
UniProt IDF7HRR2
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: MAAARGLSLTAATQRAVTPWPRGRLLAASLGLQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRQGGRDGVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry