AibGenesis™ Mouse Anti-isg12(b) Antibody (CBMOAB-45590FYA)
Cat: CBMOAB-45590FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-45590FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Sheep (Ovis aries) | WB, ELISA | MO45590FYA | 100 µg | ||
| MO-AB-14295R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO14295R | 100 µg | ||
| MO-AB-15832Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15832Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Sheep (Ovis aries) |
| Clone | MO45590FYA |
| Specificity | This antibody binds to Rhesus isg12(b). |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus isg12(b) Antibody is a mouse antibody against isg12(b). It can be used for isg12(b) detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Putative ISG12(B) protein; isg12(b) |
| UniProt ID | Q6IE99 |
| Protein Refseq | The length of the protein is 39 amino acids long. The sequence is show below: RGAQMPWRFTGAGIAAVSIAGKMMSAAAIANGGGVSAGS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry