AibGenesis™ Mouse Anti-JOSD2 Antibody (CBMOAB-45750FYA)


Cat: CBMOAB-45750FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45750FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45750FYA 100 µg
CBMOAB-81450FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81450FYA 100 µg
MO-AB-04591H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04591C 100 µg
MO-AB-24360W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24360W 100 µg
MO-AB-26587H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26587C 100 µg
MO-AB-57510W Monoclonal Marmoset WB, ELISA MO57510W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45750FYA
SpecificityThis antibody binds to Rhesus JOSD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus JOSD2 Antibody is a mouse antibody against JOSD2. It can be used for JOSD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesJOSD2
UniProt IDF7H0A0
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MSQGPGAQPSPPSVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRAFLATALAQGLCEVLLVVTKEVEEKGCWLRTD.
For Research Use Only | Not For Clinical Use.
Online Inquiry