AibGenesis™ Mouse Anti-KCTD2 Antibody (CBMOAB-45990FYA)


Cat: CBMOAB-45990FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-45990FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO45990FYA 100 µg
CBMOAB-81776FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO81776FYA 100 µg
MO-AB-04650H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04650C 100 µg
MO-AB-11719W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11719W 100 µg
MO-AB-26629H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26629C 100 µg
MO-AB-57687W Monoclonal Marmoset WB, ELISA MO57687W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO45990FYA
SpecificityThis antibody binds to Rhesus KCTD2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KCTD2 Antibody is a mouse antibody against KCTD2. It can be used for KCTD2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBTB/POZ domain-containing protein KCTD2; KCTD2
UniProt IDI2CTZ1
Protein RefseqThe length of the protein is 263 amino acids long.
The sequence is show below: MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPGPPERAGGGGAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYLIDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQGPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNNSTNGIVIEPSEKAKILQERGSRM.
For Research Use Only | Not For Clinical Use.
Online Inquiry