AibGenesis™ Mouse Anti-KHDC1 Antibody (CBMOAB-46067FYA)


Cat: CBMOAB-46067FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46067FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO46067FYA 100 µg
MO-AB-26641H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26641C 100 µg
MO-AB-57755W Monoclonal Marmoset WB, ELISA MO57755W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO46067FYA
SpecificityThis antibody binds to Rhesus KHDC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KHDC1 Antibody is a mouse antibody against KHDC1. It can be used for KHDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKH homology domain-containing protein 1; KHDC1
UniProt IDI0FKJ5
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MDMGTSALSKKPWWTLPENFHAPMVFHMEEDQEELIFGHGDTHLRCIEVHSHTLIQLESWFTATGQTRVTVVGPHRARQWLLHMFCCVGSQDSYHHARGLEMLEQVRSQPLTNDDLVTSISVPPYTGDLSLAPRISGTICLSVPQPSPYQVIGCSGFHLSSLYP.
For Research Use Only | Not For Clinical Use.
Online Inquiry