AibGenesis™ Mouse Anti-KLRF1 Antibody (CBMOAB-46563FYA)


Cat: CBMOAB-46563FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46563FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO46563FYA 100 µg
MO-AB-14679R Monoclonal Cattle (Bos taurus) WB, ELISA MO14679R 100 µg
MO-AB-22102W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22102W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO46563FYA
SpecificityThis antibody binds to Rhesus KLRF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus KLRF1 Antibody is a mouse antibody against KLRF1. It can be used for KLRF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesKLRF1
UniProt IDF6QEC3
Protein RefseqThe length of the protein is 181 amino acids long.
The sequence is show below: MQDEERYMTLNVQSKKRTSTQTTQLTFKDYSVVLHWYKILLGISGTLNGILALALISLILLVLCQSEWLKYRGKCYWFSNEMKSWSDSYVYCLERKSHLLIIQDELEMAFIQKNLRQSNYVWMGLNFTSLKMTWTWVDGSPLDPKIFFIKGPAKENSCAAIKESKIYSETCSSVFKWICQY.
For Research Use Only | Not For Clinical Use.
Online Inquiry