AibGenesis™ Mouse Anti-LAPTM5 Antibody (CBMOAB-46760FYA)


Cat: CBMOAB-46760FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46760FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset WB, ELISA MO46760FYA 100 µg
MO-AB-14815R Monoclonal Cattle (Bos taurus) WB, ELISA MO14815R 100 µg
MO-AB-35043W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35043W 100 µg
MO-AB-58055W Monoclonal Marmoset WB, ELISA MO58055W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Ferret (Mustela Putorius Furo), Marmoset
CloneMO46760FYA
SpecificityThis antibody binds to Rhesus LAPTM5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Lysosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LAPTM5 Antibody is a mouse antibody against LAPTM5. It can be used for LAPTM5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLysosomal-associated transmembrane protein 5; LAPTM5
UniProt IDI0FJG0
Protein RefseqThe length of the protein is 262 amino acids long.
The sequence is show below: MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSIEVAHGKASCKLSKMGYLRIADLISSFMLIAMLFVISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASPSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPYNQFIKMMIIFSTAFITVLIFKVYMFKCVWRCYRFIKCLNSIEERSNSKMFQKVVLPSYEEALSLPSKTPEGDPAPPPYSEV.
For Research Use Only | Not For Clinical Use.
Online Inquiry