AibGenesis™ Mouse Anti-LGI3 Antibody (CBMOAB-46901FYA)


Cat: CBMOAB-46901FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-46901FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO46901FYA 100 µg
CBMOAB-82664FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO82664FYA 100 µg
MO-AB-02726Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02726Y 100 µg
MO-AB-26786H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26786C 100 µg
MO-AB-58164W Monoclonal Marmoset WB, ELISA MO58164W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO46901FYA
SpecificityThis antibody binds to Rhesus LGI3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LGI3 Antibody is a mouse antibody against LGI3. It can be used for LGI3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLeucine-rich repeat LGI family member 3; LGI3
UniProt IDH9ERA1
Protein RefseqThe length of the protein is 548 amino acids long.
The sequence is show below: MAGLRARRGPAPGLLALSALGFCLMLQVSAKRLPKTPPCPPSCSCTRDTAFCVDSKAVPRNLPSEVISLTLVNAAFSEIHDGAFSHLPLLQFLLLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWTLSKFTFRGLKSLTHLSLANNNLQTLPRDIFRPLDILNDLDLRGNSLNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPLREFDCITTDFVLYQTLSFPAVSAEPFLYSSDLYLALAQPGVSACTILKWDYVERQLRDYDRIPAPSAVHCKPMVVDSQLYVVVAQLFGGSYIYHWDPNTTRFTKLQDIDPQRVRKPNDLEAFRIDGDWYFAVADSSKAGATSLYRWHQNGFYSHQALHPWHRDTDLEFVDGEGKPRLIVSSSSQAPVIYQWSRTQKQFVAQGEVTQVPDAQAVKHFRAGRDSYLCLSRYIGDSKILRWEGTRFSEVQALPSRGSLALQPFLVGGRRYLALGSDFSFTQIYQWDEGRQKFVRFQELAVQAPRAFCYMPAGDAQLLLAPSFKGQTLVYRHVVVDLSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry