AibGenesis™ Mouse Anti-LRRC75A Antibody (CBMOAB-49252FYA)


Cat: CBMOAB-49252FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49252FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO49252FYA 100 µg
MO-AB-18479W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18479W 100 µg
MO-AB-58387W Monoclonal Marmoset WB, ELISA MO58387W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO49252FYA
SpecificityThis antibody binds to Rhesus LRRC75A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus LRRC75A Antibody is a mouse antibody against LRRC75A. It can be used for LRRC75A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLRRC75A
UniProt IDF6Y8L9
Protein RefseqThe length of the protein is 222 amino acids long.
The sequence is show below: LLLQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKPEGDALGTMEKLCRQLTYHLSPHSQWRRHRGLVKRKPQACLKAVLAGSPPDNTVDLSGIPLTSRDLERVTSYLQRCGEQVDSVELGFTGLTDDMVLQLLPALSTLPRLTTLALNGNRLTRAVLRDLTDILKDPSKFPNVTWIDLGNNVDIFSLPQPFLLSLRKRSPKQGHLPTILE.
For Research Use Only | Not For Clinical Use.
Online Inquiry