AibGenesis™ Mouse Anti-MALRD1 Antibody (CBMOAB-49489FYA)


Cat: CBMOAB-49489FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-49489FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO49489FYA 100 µg
CBMOAB-85771FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO85771FYA 100 µg
MO-AB-04233W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04233W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO49489FYA
SpecificityThis antibody binds to Rhesus MALRD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a conserved protein that features multiple MAM (meprin-A5-protein tyrosine phosphatase mu) and LDLR A2 (low density lipoprotein receptor A2) domains. Expression of this gene is enriched in the small intestine and is upregulated during differentiation of a human cell line that exhibits properties of intestinal epithelial cells. The encoded protein has been shown to modulate production of FGF19 in a human intestinal cell line and may regulate bile acid metabolism in the liver. A synergistic interaction between an allele of this gene and the APOE E4 allele is associated with an elevated risk of Alzheimer's disease in human patients. (From NCBI)
Product OverviewMouse Anti-Rhesus MALRD1 Antibody is a mouse antibody against MALRD1. It can be used for MALRD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMALRD1
UniProt IDF7GXK8
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: YTSTTGSCNFETSSGNWTTACSLTQDSEDDLDWAIGSRIPAEALIPDSDHTPGIGKHFLYVNSSGSKEGSIARVTTSKSFPASLGMCTVRFWFYTIDPRSMGILKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry