Mouse Anti-Rhesus MAP4K1 Antibody (CBMOAB-50795FYA)


Cat: CBMOAB-50795FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO50795FYA
SpecificityThis antibody binds to Rhesus MAP4K1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMAP4K1 (Mitogen-Activated Protein Kinase Kinase Kinase Kinase 1) is a Protein Coding gene. Among its related pathways are Kit receptor signaling pathway and TGF-Beta Pathway. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is MAP4K5.
Product OverviewMouse Anti-Rhesus MAP4K1 Antibody is a mouse antibody against MAP4K1. It can be used for MAP4K1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMAP4K1
UniProt IDF7DZ75
Protein RefseqThe length of the protein is 482 amino acids long.
The sequence is show below: MDLVDPDIFNRDPRDHYDLLQRLGGGTYGEVFKARDKATGDLVALKMVKMEPDDDVSTLQKEILILKTCRHANIVAYHGSYLWLQKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANILINDAGEVRLGDFALLPRPEATMLSRDGVLISCPGWMAPEVAAVALKGGYNELCDIWSLGITAIELAELQPPLFDVHPLRVLFLMTKSGYQPPRMKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSHQLVSQPGLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCHDHRVPRETSEISSEPQYPNGSQKPLRHLTLSPRLDQNQSSLNPPDLRPHPTPAEDTPPPLPPKPKFRSPSDEGPGGMGDDGRLSPGVLVRCASGPPPHNPRPGPPPSTSSPHLTAHSEPSLWNPPSRELDKPPLLPPKKEKMKRK.
See other products for " MAP4K1 "
CBMOAB-36207FYCMouse Anti-Arabidopsis MAP4K1 Antibody (CBMOAB-36207FYC)
MO-AB-35089WMouse Anti-Ferret MAP4K1 Antibody (MO-AB-35089W)
MO-AB-42051WMouse Anti-Guinea pig MAP4K1 Antibody (MO-AB-42051W)
MO-AB-15500WMouse Anti-Chimpanzee MAP4K1 Antibody (MO-AB-15500W)
MO-AB-27132RMouse Anti-Pig MAP4K1 Antibody (MO-AB-27132R)
MO-AB-15330RMouse Anti-Cattle MAP4K1 Antibody (MO-AB-15330R)
MO-AB-45443WMouse Anti-Horse MAP4K1 Antibody (MO-AB-45443W)
MO-AB-00783LMouse Anti-Elephant MAP4K1 Antibody (MO-AB-00783L)
MO-AB-31680WMouse Anti-Dog MAP4K1 Antibody (MO-AB-31680W)
MO-AB-08207WMouse Anti-Cat MAP4K1 Antibody (MO-AB-08207W)
For Research Use Only | Not For Clinical Use.
Online Inquiry