AibGenesis™ Mouse Anti-MARVELD3 Antibody (CBMOAB-50896FYA)


Cat: CBMOAB-50896FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50896FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO50896FYA 100 µg
CBMOAB-86071FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86071FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO50896FYA
SpecificityThis antibody binds to Rhesus MARVELD3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MARVELD3 Antibody is a mouse antibody against MARVELD3. It can be used for MARVELD3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMARVELD3
UniProt IDF6QXI8
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: RDRDRKRERKRDPDRGPRRDRHRDAGPRAGEHGVWEKPRQSRTRDGALGPTWDSAAPPGHAPWEAPEPPQTQRKGGPGYRGPESEPPSGRYLPSTPRPGREEVEYYQSEAEGLLECHKCKYLCTGRACCQMLEVLLNLLILACSSVSYSSTGGYTGITSLGGIYYYQFGGAYSGFDVVRVRQLDQQYTILRSPLIYGGVAFSLGLGVLTMGVLLQGAKSLTMLSGKWLLTEAAFSLLAAVGYCTGIGVYLHVALQINSTDTCKTRERLYARRGLTWMNCQLAGTDGAAATFACLLVIMYGASVVLALRSYREQKRYKSSREQPGSYSEAPEYLWSGTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry