AibGenesis™ Mouse Anti-MCCD1 Antibody (CBMOAB-50973FYA)


Cat: CBMOAB-50973FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50973FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO50973FYA 100 µg
MO-AB-06630Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06630Y 100 µg
MO-AB-58843W Monoclonal Marmoset WB, ELISA MO58843W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, O. anatinus (Ornithorhynchus anatinus)
CloneMO50973FYA
SpecificityThis antibody binds to Rhesus MCCD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMCCD1 (Mitochondrial Coiled-Coil Domain 1) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus MCCD1 Antibody is a mouse antibody against MCCD1. It can be used for MCCD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMCCD1
UniProt IDF7EWD9
Protein RefseqThe length of the protein is 119 amino acids long.
The sequence is show below: MVPPLPWLSRCHFLRLLLPSWPLAPQGSRGCCSQNPKASMEEQTSSRGNGKMTSTPRGPGIHRTAELAQAEELLEQQLELYQALLEGQEGAWEAQALVLKIQKLKEQMRRHRESLGGGA.
For Research Use Only | Not For Clinical Use.
Online Inquiry