AibGenesis™ Mouse Anti-MCEE Antibody (CBMOAB-50974FYA)


Cat: CBMOAB-50974FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-50974FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO50974FYA 100 µg
CBMOAB-86262FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86262FYA 100 µg
MO-AB-05074H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05074C 100 µg
MO-AB-15449R Monoclonal Cattle (Bos taurus) WB, ELISA MO15449R 100 µg
MO-AB-26990H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26990C 100 µg
MO-AB-27217R Monoclonal Pig (Sus scrofa) WB, ELISA MO27217R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Pig (Sus scrofa), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO50974FYA
SpecificityThis antibody binds to Rhesus MCEE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. (From NCBI)
Product OverviewMouse Anti-Rhesus MCEE Antibody is a mouse antibody against MCEE. It can be used for MCEE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMCEE
UniProt IDF6VQY5
Protein RefseqThe length of the protein is 176 amino acids long.
The sequence is show below: MARALRAAAGNAIGLFSRLQAPIPTLRASSTSQPLDQVAGSLWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKTKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry