Mouse Anti-Rhesus MED28 Antibody (MO-AB-04371W)


Cat: MO-AB-04371W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO04371W
SpecificityThis antibody binds to Rhesus MED28.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMED28 (Mediator Complex Subunit 28) is a Protein Coding gene. Among its related pathways are PEDF Induced Signaling and Thyroid hormone signaling pathway. Gene Ontology (GO) annotations related to this gene include receptor activity and transcription cofactor activity.
Product OverviewMouse Anti-Rhesus MED28 Antibody is a mouse antibody against MED28. It can be used for MED28 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator complex subunit 28; MED28
UniProt IDG7MSM6
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEEINVQHKKPADIPQGSLAYLEQASANIPAPLKPT.
See other products for " MED28 "
MO-AB-15527RMouse Anti-Cattle MED28 Antibody (MO-AB-15527R)
CBMOAB-51113FYAMouse Anti-Rhesus MED28 Antibody (CBMOAB-51113FYA)
CBMOAB-23587FYAMouse Anti-D. melanogaster Med28 Antibody (CBMOAB-23587FYA)
MO-AB-27038HMouse Anti-Rat Med28 Antibody (MO-AB-27038H)
CBMOAB-36358FYCMouse Anti-Arabidopsis MED28 Antibody (CBMOAB-36358FYC)
CBMOAB-86454FYAMouse Anti-Zebrafish med28 Antibody (CBMOAB-86454FYA)
MO-AB-58939WMouse Anti-Marmoset MED28 Antibody (MO-AB-58939W)
MO-AB-10901WMouse Anti-Chimpanzee MED28 Antibody (MO-AB-10901W)
For Research Use Only | Not For Clinical Use.
Online Inquiry