AibGenesis™ Mouse Anti-MEGF11 Antibody (CBMOAB-51129FYA)


Cat: CBMOAB-51129FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51129FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO51129FYA 100 µg
CBMOAB-86500FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86500FYA 100 µg
MO-AB-04379W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04379W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO51129FYA
SpecificityThis antibody binds to Rhesus MEGF11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MEGF11 Antibody is a mouse antibody against MEGF11. It can be used for MEGF11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMultiple epidermal growth factor-like domains protein 11; MEGF11
UniProt IDH9FHH0
Protein RefseqThe length of the protein is 178 amino acids long.
The sequence is show below: LHTCSCHNGASCSAEDGACHCTPGWTGLFCTQRCPAAFFGKDCGRVCQCQNGASCDHISGKCTCRTGFTGQHCEQRCAPGTFGYGCQQLCECMNNSTCDHVTGTCYCSPGFKGIRCDQAALMMEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQKEKGRDLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry