AibGenesis™ Mouse Anti-METTL4 Antibody (CBMOAB-51199FYA)


Cat: CBMOAB-51199FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51199FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) WB, ELISA MO51199FYA 100 µg
MO-AB-16139Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16139Y 100 µg
MO-AB-25027W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25027W 100 µg
MO-AB-59011W Monoclonal Marmoset WB, ELISA MO59011W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries)
CloneMO51199FYA
SpecificityThis antibody binds to Rhesus METTL4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus METTL4 Antibody is a mouse antibody against METTL4. It can be used for METTL4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMETTL4
UniProt IDF6YE76
Protein RefseqThe length of the protein is 472 amino acids long.
The sequence is show below: MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCSKNEFTTSVHFESLQMDSVSSSGACAAFIASDPTTKPENDDGGSYEMLTQKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNGVKKEISISIIGKKRKRCVIFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKCSKPITLPLDTCNLPELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQENTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry