AibGenesis™ Mouse Anti-MIS18A Antibody (CBMOAB-51452FYA)


Cat: CBMOAB-51452FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51452FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO51452FYA 100 µg
CBMOAB-86976FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO86976FYA 100 µg
MO-AB-02913Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02913Y 100 µg
MO-AB-12306W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12306W 100 µg
MO-AB-15816R Monoclonal Cattle (Bos taurus) WB, ELISA MO15816R 100 µg
MO-AB-27113H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27113C 100 µg
MO-AB-59130W Monoclonal Marmoset WB, ELISA MO59130W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO51452FYA
SpecificityThis antibody binds to Rhesus MIS18A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus MIS18A Antibody is a mouse antibody against MIS18A. It can be used for MIS18A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Mis18-alpha; MIS18A
UniProt IDI0FSQ6
Protein RefseqThe length of the protein is 232 amino acids long.
The sequence is show below: MAGVRALRCSRGCAGGCECGDKGKGSDSPLLGKRLSEDSSRHQLLQKWASMWSSVSEDASVADTEKARLEEAGAAEERPLVFLCCGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCILETLYCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry