Mouse Anti-Rhesus MRC1 Antibody (CBMOAB-51671FYA)


Cat: CBMOAB-51671FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO51671FYA
SpecificityThis antibody binds to Rhesus MRC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe recognition of complex carbohydrate structures on glycoproteins is an important part of several biological processes, including cell-cell recognition, serum glycoprotein turnover, and neutralization of pathogens. The protein encoded by this gene is a type I membrane receptor that mediates the endocytosis of glycoproteins by macrophages. The protein has been shown to bind high-mannose structures on the surface of potentially pathogenic viruses, bacteria, and fungi so that they can be neutralized by phagocytic engulfment.
Product OverviewMouse Anti-Rhesus MRC1 Antibody is a mouse antibody against MRC1. It can be used for MRC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative: macrophage mannose receptor 1-like; MRC1
UniProt IDH9FG05
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: SCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPTHCPSQWWPYAGHCYKIHKDEKKIQRDALTACRKEGGDLASIHTIEEFDFIISQLGYEPNDELWIGLNDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry