Mouse Anti-Rhesus MRPL52 Antibody (MO-AB-04484W)


Cat: MO-AB-04484W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO04484W
SpecificityThis antibody binds to Rhesus MRPL52.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein which has no bacterial homolog. Multiple transcript variants encoding different protein isoforms were identified through sequence analysis.
Product OverviewMouse Anti-Rhesus MRPL52 Antibody is a mouse antibody against MRPL52. It can be used for MRPL52 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names39S ribosomal protein L52, mitochondrial isoform c; MRPL52
UniProt IDI2CTA4
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MAALATVLFSVRRLHCGAAAWAGSQWRLQQGLAANPSGYGPLTDLPDWSYADGRPAPPMKGQLRRKAEREKFARRVVLLSQEMDTGLQAWQLRQQKLQEEQRKKENALKSKGASLKSPLPSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry