Mouse Anti-Rhesus MRPS7 Antibody (CBMOAB-51780FYA)


Cat: CBMOAB-51780FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO51780FYA
SpecificityThis antibody binds to Rhesus MRPS7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. In the prokaryotic ribosome, the comparable protein is thought to play an essential role in organizing the 3' domain of the 16 S rRNA in the vicinity of the P- and A-sites. Pseudogenes corresponding to this gene are found on chromosomes 8p and 12p.
Product OverviewMouse Anti-Rhesus MRPS7 Antibody is a mouse antibody against MRPS7. It can be used for MRPS7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMRPS7
UniProt IDF7DH48
Protein RefseqThe length of the protein is 239 amino acids long.
The sequence is show below: MPIVKSNLLACGVSFCLSPPLPPPRLTQVRWSRYSPEFKDPLIDKEYYRKPVEELTEEEKYDRELKKTQLIKAAPAGKTSSVFEDPVISKFTNMMMKGGNKVLARSLVTQTLEAVKRKQFEKYHSASAEEQATIERNPYTIFHQALKNCEPVIGLVPILKGGRFYQVPVPLPDQRRRFLAMKWMITECRENKHRRTLMPEKLSHELLEAFHNRGPVIKRKHEMHKMAEANRALAHYRWW.
For Research Use Only | Not For Clinical Use.
Online Inquiry