AibGenesis™ Mouse Anti-MS4A3 Antibody (CBMOAB-51798FYA)


Cat: CBMOAB-51798FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-51798FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus) WB, ELISA MO51798FYA 100 µg
Inquiry
MO-AB-27250H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27250C 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus)
CloneMO51798FYA
SpecificityThis antibody binds to Rhesus MS4A3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. (From NCBI)
Product OverviewMouse Anti-Rhesus MS4A3 Antibody is a mouse antibody against MS4A3. It can be used for MS4A3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMS4A3
UniProt IDF6Z747
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MASHVVDNAELGSASAHGTPGSEAGPHQLNNSVYQPIDGSQDYQKGKLQVLGAIQILNAAMILALGVLLGSLQYLFHLQRHLFFFTFYTGYPFWGAAFFCSSGTLSVVAGRKPTRTWIRKSFEMNIASATIAVVGIAFLSVNLAVNIQLLNICQSSTSPDLCNYMGSTSNGMVSLLLILTSLELCVTISTFAMLCKANCCNSRVDISSPPNSVESRMPPYENNSESMNI.
For Research Use Only | Not For Clinical Use.
Online Inquiry