AibGenesis™ Mouse Anti-N6AMT2 Antibody (CBMOAB-52155FYA)


Cat: CBMOAB-52155FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52155FYA Monoclonal Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO52155FYA 100 µg
CBMOAB-88237FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88237FYA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO52155FYA
SpecificityThis antibody binds to Rhesus N6AMT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProtein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus N6AMT2 Antibody is a mouse antibody against N6AMT2. It can be used for N6AMT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN(6)-adenine-specific DNA methyltransferase 2; N6AMT2
UniProt IDI2CY46
Protein RefseqThe length of the protein is 214 amino acids long.
The sequence is show below: MSDLEDDETPQLSAHALAALQEFYAEQKQQIDLGEDDKYNIGIIEENWQLSQFWYSQETALRLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFTVYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETIKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPKHTRNLANEFRCYVNYDSGLDCGI.
For Research Use Only | Not For Clinical Use.
Online Inquiry