AibGenesis™ Mouse Anti-NAA40 Antibody (CBMOAB-52166FYA)


Cat: CBMOAB-52166FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52166FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO52166FYA 100 µg
CBMOAB-88260FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO88260FYA 100 µg
MO-AB-16349R Monoclonal Cattle (Bos taurus) WB, ELISA MO16349R 100 µg
MO-AB-18242W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18242W 100 µg
MO-AB-27373H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27373C 100 µg
MO-AB-59691W Monoclonal Marmoset WB, ELISA MO59691W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO52166FYA
SpecificityThis antibody binds to Rhesus NAA40.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionN-alpha-acetyltransferase that specifically mediates the acetylation of the N-terminal residues of histones H4 and H2A (PubMed:21935442, PubMed:25619998). In contrast to other N-alpha-acetyltransferase, has a very specific selectivity for histones H4 and H2A N-terminus and specifically recognizes the Ser-Gly-Arg-Gly sequence (PubMed:21935442, PubMed:25619998). Acts as a negative regulator of apoptosis (PubMed:26666750). May play a role in hepatic lipid metabolism. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rhesus NAA40 Antibody is a mouse antibody against NAA40. It can be used for NAA40 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAA40
UniProt IDF7CF60
Protein RefseqThe length of the protein is 115 amino acids long.
The sequence is show below: LGRKSSQAKEKRQKRLEEGAAMDAVDAANRLGDPLEAFPVFKKHDRNGLNVSIECKRVSGPEPATLDWAFDLTKTNMQTICEVQLESKVRRKGLGKLLMQTLQLMANSTQMKEVM.
For Research Use Only | Not For Clinical Use.
Online Inquiry