Mouse Anti-Rhesus NAF1 Antibody (MO-AB-04587W)
Cat: MO-AB-04587W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO04587W |
Specificity | This antibody binds to Rhesus NAF1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | RNA-binding protein required for the maturation of box H/ACA snoRNPs complex and ribosome biogenesis. During assembly of the H/ACA snoRNPs complex, it associates with the complex and disappears during maturation of the complex and is replaced by NOLA1/GAR1 to yield mature H/ACA snoRNPs complex. Probably competes with NOLA1/GAR1 for binding with DKC1/NOLA4. |
Product Overview | Mouse Anti-Rhesus NAF1 Antibody is a mouse antibody against NAF1. It can be used for NAF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | H / ACA ribonucleoprotein complex non-core subunit NAF1 isoform b; NAF1 |
UniProt ID | H9F244 |
Protein Refseq | The length of the protein is 40 amino acids long. The sequence is show below: HRYCGLRSRPLRSNKSHKVFGFQMHIKVMFTRYCRLLSIQ. |
See other products for " NAF1 "
CBMOAB-37138FYC | Mouse Anti-Arabidopsis NAF1 Antibody (CBMOAB-37138FYC) |
MO-AB-17034W | Mouse Anti-Chimpanzee NAF1 Antibody (MO-AB-17034W) |
MO-AB-59706W | Mouse Anti-Marmoset NAF1 Antibody (MO-AB-59706W) |
MO-AB-27530R | Mouse Anti-Pig NAF1 Antibody (MO-AB-27530R) |
CBMOAB-52200FYA | Mouse Anti-Rhesus NAF1 Antibody (CBMOAB-52200FYA) |
CBMOAB-02532CR | Mouse Anti-Yeast NAF1 Antibody (CBMOAB-02532CR) |
CBMOAB-88313FYA | Mouse Anti-Zebrafish naf1 Antibody (CBMOAB-88313FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry