AibGenesis™ Mouse Anti-NAP1L4 Antibody (CBMOAB-52230FYA)


Cat: CBMOAB-52230FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52230FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish WB, ELISA MO52230FYA 100 µg
MO-AB-11400W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11400W 100 µg
MO-AB-16374R Monoclonal Cattle (Bos taurus) WB, ELISA MO16374R 100 µg
MO-AB-27541R Monoclonal Pig (Sus scrofa) WB, ELISA MO27541R 100 µg
MO-AB-59718W Monoclonal Marmoset WB, ELISA MO59718W 100 µg
MOFY-1222-FY39 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Zebrafish
CloneMO52230FYA
SpecificityThis antibody binds to Rhesus NAP1L4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nucleosome assembly protein (NAP) family which can interact with both core and linker histones. It can shuttle between the cytoplasm and nucleus, suggesting a role as a histone chaperone. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. (From NCBI)
Product OverviewMouse Anti-Rhesus NAP1L4 Antibody is a mouse antibody against NAP1L4. It can be used for NAP1L4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNAP1L4
UniProt IDF7BXG6
Protein RefseqThe length of the protein is 376 amino acids long.
The sequence is show below: MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDSVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDKRREFITGDVEPTDAESEWHSENEEEEKLAGDMKNKVVITEKEAATAEEPNPKGIPEFWFTIFRNVDMLSELVQEYDEPILKHLQDIKVKFSDPGQPMSFVLEFHFEPNDYFTNSVLTKTYKMKSEPDKADPFSFEGPEIVDCDGCTIDWKKGKNVTVKTIKKKQKHKGRGTTLVLFFQASVVSRGTLLCPRLFSSGDGESLDEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDNFEEGEEGEEEELEGDEEGEDEDDAEINPKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry