Mouse Anti-Rhesus NAT6 Antibody (MO-AB-04593W)


Cat: MO-AB-04593W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO04593W
SpecificityThis antibody binds to Rhesus NAT6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the N-acetyltransferase family. N-acetyltransferases modify proteins by transferring acetyl groups from acetyl CoA to the N-termini of protein substrates. The encoded protein is a cytoplasmic N-acetyltransferase with a substrate specificity for proteins with an N-terminal methionine. This gene is located in the tumor suppressor gene region on chromosome 3p21.3 and the encoded protein may play a role in cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed. This gene overlaps and is on the same strand as hyaluronoglucosaminidase 3, and some transcripts of each gene share a portion of the first exon.
Product OverviewMouse Anti-Rhesus NAT6 Antibody is a mouse antibody against NAT6. It can be used for NAT6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-acetyltransferase 6 isoform 1; NAT6
UniProt IDH9FSA8
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTVDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRASRLHSLGQSSDAFPLCLMLLSPHPTSEAAPIVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRCLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGKPVQGLVFTSRRLPATLLNAFPTGPSPRPPWKAPNLTAQAAPRGPKGLPLPPPPPLPECLTTSPPVPSGPPSKSLLETQYQNVRGRPVFWMEKDI.
For Research Use Only | Not For Clinical Use.
Online Inquiry