AibGenesis™ Mouse Anti-NIPA2 Antibody (CBMOAB-52654FYA)


Cat: CBMOAB-52654FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52654FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio) WB, ELISA MO52654FYA 100 µg
CBMOAB-89027FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89027FYA 100 µg
MO-AB-03132Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03132Y 100 µg
MO-AB-05627H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05627C 100 µg
MO-AB-16746R Monoclonal Cattle (Bos taurus) WB, ELISA MO16746R 100 µg
MO-AB-24372W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24372W 100 µg
MO-AB-27748R Monoclonal Pig (Sus scrofa) WB, ELISA MO27748R 100 µg
MO-AB-60078W Monoclonal Marmoset WB, ELISA MO60078W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Zebrafish (Danio rerio)
CloneMO52654FYA
SpecificityThis antibody binds to Rhesus NIPA2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a possible magnesium transporter. This gene is located adjacent to the imprinted domain in the Prader-Willi syndrome deletion region of chromosome 15. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 7 and 21. (From NCBI)
Product OverviewMouse Anti-Rhesus NIPA2 Antibody is a mouse antibody against NIPA2. It can be used for NIPA2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNIPA2
UniProt IDF7DAY9
Protein RefseqThe length of the protein is 341 amino acids long.
The sequence is show below: MSQGRGKYDFYIGLGLAMSSSIFIGGSFILKKKGLLRLARKGSMRAVGAGEVANFAAYAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFAVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIALKELFAGKPVLRHPLAWVLLLSLIVCVSTQINYLNRALDIFNTSIVTPIYYVFFTTSVLTCSAILFKEWQDMPGDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPVSFRKDEKAVNGNLSNMYEVLNNNEESLTCGIEQHTGENVSRRNGNLTAF.
For Research Use Only | Not For Clinical Use.
Online Inquiry