AibGenesis™ Mouse Anti-NKAIN2 Antibody (CBMOAB-52678FYA)


Cat: CBMOAB-52678FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-52678FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO52678FYA 100 µg
CBMOAB-89353FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO89353FYA 100 µg
MO-AB-04737W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04737W 100 µg
MO-AB-16755R Monoclonal Cattle (Bos taurus) WB, ELISA MO16755R 100 µg
MO-AB-60091W Monoclonal Marmoset WB, ELISA MO60091W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO52678FYA
SpecificityThis antibody binds to Rhesus NKAIN2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transmembrane protein that interacts with the beta subunit of a sodium/potassium-transporting ATPase. A chromosomal translocation involving this gene is a cause of lymphoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus NKAIN2 Antibody is a mouse antibody against NKAIN2. It can be used for NKAIN2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNKAIN2
UniProt IDF6XKU1
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: VCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPRYITGYAVWLVLWVTWNVFVICFYLEAGDLSKSTDLVKTFNLTFYKAWTFENSIGQVLSSALISPDRAPPRSSYISLYGKLVKNMDSGVSHPGISVLFQLAGFIYACYVVKCITEEEDSFDFIGGFDSYGYQGPQKTSHLQLQPMYM.
For Research Use Only | Not For Clinical Use.
Online Inquiry