AibGenesis™ Mouse Anti-NT5C3 Antibody (CBMOAB-53063FYA)


Cat: CBMOAB-53063FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53063FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO53063FYA 100 µg
CBMOAB-90158FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO90158FYA 100 µg
MO-AB-10037W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10037W 100 µg
MO-AB-27187W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27187W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO53063FYA
SpecificityThis antibody binds to Rhesus NT5C3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus NT5C3 Antibody is a mouse antibody against NT5C3. It can be used for NT5C3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNT5C3
UniProt IDF7HEF8
Protein RefseqThe length of the protein is 297 amino acids long.
The sequence is show below: MTNQESAVHVKMMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVEQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMNSYDIVLVQDESLEVANSILQKIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry