Mouse Anti-Rhesus NUDC Antibody (MO-AB-04831W)


Cat: MO-AB-04831W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO04831W
SpecificityThis antibody binds to Rhesus NUDC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear distribution protein that plays an essential role in mitosis and cytokinesis. The encoded protein is involved in spindle formation during mitosis and in microtubule organization during cytokinesis. Pseudogenes of this gene are found on chromosome 2.
Product OverviewMouse Anti-Rhesus NUDC Antibody is a mouse antibody against NUDC. It can be used for NUDC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear Distribution C, Dynein Complex Regulator; Nuclear Distribution Protein C Homolog; NudC Nuclear Distribution Protein; Nuclear Distribution Gene C Homolog (A. Nidulans); Nuclear Distribution C Homolog (A. Nidulans); Nuclear Distribution Gene C Homolog
UniProt IDF6T9J7
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: MGGEQEEERFDGMLLAMAQQHEGGVQELVNTFFSFLRRKTDFFIGGEEGMAEKLITQTFSHHNQLAQKTRREKRARQEAERREKAERAARLAKEAKSETSGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPGKQETEEDEEEEDEKDKGKLKPNLGNGADLPNYRWSQTLCRKGSLVPLPSIGLQGSQVQDMDEREFVVKGLRGDSWCTEQATSHPLVINKMEWWSRLVSSDPEINTKKINPENSKLSDLDSETRSMVEKMMYDQRQKSMGLPTSDEQKKQEILKKFMDQHPEMDFSKAKFN.
For Research Use Only | Not For Clinical Use.
Online Inquiry