AibGenesis™ Mouse Anti-ODF4 Antibody (CBMOAB-53309FYA)


Cat: CBMOAB-53309FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-53309FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO53309FYA 100 µg
Inquiry
MO-AB-17127R Monoclonal Cattle (Bos taurus) WB, ELISA MO17127R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO53309FYA
SpecificityThis antibody binds to Rhesus ODF4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is localized in the outer dense fibers of the tails of mature sperm. This protein is thought to have some important role in the sperm tail. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ODF4 Antibody is a mouse antibody against ODF4. It can be used for ODF4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOuter dense fiber protein 4; ODF4
UniProt IDH9F2B9
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: VTFIFFTLKLFPINIWIFEVERNVSIPIGWSYFIGWLVLILYVSCAILCYFNYKSFWSLILSHPSGTVSCSSSFGSAEEPPRAQMITDTPITQEGVLDPERKDTHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry